Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence20.35%DateThu Jan 5 11:46:18 GMT 2012
Rank120Aligned Residues30
% Identity37%Templatec2vdcI_
PDB info PDB header:oxidoreductaseChain: I: PDB Molecule:glutamate synthase [nadph] small chain; PDBTitle: the 9.5 a resolution structure of glutamate synthase from2 cryo-electron microscopy and its oligomerization behavior3 in solution: functional implications.
Resolution9.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60
Predicted Secondary structure 























Query SS confidence 
























































Query Sequence  KDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation    





   

                       

   
 
  

 

     
Alig confidence 








...........................




















Template Conservation 








...........................







  


 
  
 

Template Sequence  GLSVGVIGA. . . . . . . . . . . . . . . . . . . . . . . . . . . GPAGLAAAEELRAKGYEVHVY
Template Known Secondary structure 




...........................ST

Template Predicted Secondary structure 



...........................




Template SS confidence 
























































   147..150..... ....160.........170......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions