Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence27.93%DateThu Jan 5 11:46:18 GMT 2012
Rank94Aligned Residues36
% Identity33%Templatec2ppvA_
PDB info PDB header:transferaseChain: A: PDB Molecule:uncharacterized protein; PDBTitle: crystal structure of a protein belonging to the upf0052 (se_0549) from2 staphylococcus epidermidis atcc 12228 at 2.00 a resolution
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   3......10.........20.........30.........40..... ....50.........60......
Predicted Secondary structure 




















.






Query SS confidence 










































.




















Query Sequence  EKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRN. IAQNLALLGNKAWLLSAVGSD
Query Conservation     





   

                       

   
. 
  

 

     
  

 
Alig confidence 








............................





.




















Template Conservation     


   ............................



   

 

      

 



 

Template Sequence  KQXNVVLIG. . . . . . . . . . . . . . . . . . . . . . . . . . . . GGTGLSVLARGLREFPIDITAIVTVADN
Template Known Secondary structure 

............................
TTSS




Template Predicted Secondary structure 


............................












Template SS confidence 
































































   2.......10 .........20.........30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions