Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence24.63%DateThu Jan 5 11:46:18 GMT 2012
Rank101Aligned Residues33
% Identity30%Templatec2b9yA_
PDB info PDB header:isomeraseChain: A: PDB Molecule:putative aminooxidase; PDBTitle: crystal structure of cla-producing fatty acid isomerase2 from p. acnes
Resolution2.21 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50..... ....60
Predicted Secondary structure 

























.
Query SS confidence 






















































.




Query Sequence  MREKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGN. KAWLL
Query Conservation 
    





   

                       

   
 
  

 

 .    
Alig confidence 










...........................
















.




Template Conservation        
 


...........................

 


 

  
   
   
 
 
Template Sequence  ISKDSRIAIIG. . . . . . . . . . . . . . . . . . . . . . . . . . . AGPAGLAAGMYLEQAGFHDYTIL
Template Known Secondary structure 

TT


...........................
STT


Template Predicted Secondary structure 






...........................





Template SS confidence 




























































   3......10... ......20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions