Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence32.23%DateThu Jan 5 11:46:18 GMT 2012
Rank88Aligned Residues33
% Identity33%Templatec1vdcA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:nadph dependent thioredoxin reductase; PDBTitle: structure of nadph dependent thioredoxin reductase
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1. .......10.........20.........30.........40.........50.........60
Predicted Secondary structure 

.
























Query SS confidence 

.

























































Query Sequence  MR. EKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation 
 .   





   

                       

   
 
  

 

     
Alig confidence 

.









...........................




















Template Conservation 
     






...........................
 


 

  

  
  
 

Template Sequence  LETHNTRLCIVGS. . . . . . . . . . . . . . . . . . . . . . . . . . . GPAAHTAAIYAARAELKPLLF
Template Known Secondary structure 


...........................STT


Template Predicted Secondary structure 







...........................




Template SS confidence 




























































   1........10... ......20.........30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions