Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence35.48%DateThu Jan 5 11:46:18 GMT 2012
Rank81Aligned Residues32
% Identity38%Templatec1ps9A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:2,4-dienoyl-coa reductase; PDBTitle: the crystal structure and reaction mechanism of e. coli 2,4-2 dienoyl coa reductase
Resolution2.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   2.......10.........20.........30.........40.........50.........60
Predicted Secondary structure 

























Query SS confidence 


























































Query Sequence  REKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation      





   

                       

   
 
  

 

     
Alig confidence 










...........................




















Template Conservation     







...........................
 





  

  
  



Template Sequence  VQKKNLAVVGA. . . . . . . . . . . . . . . . . . . . . . . . . . . GPAGLAFAINAAARGHQVTLF
Template Known Secondary structure  SS



...........................STTT
Template Predicted Secondary structure 






...........................




Template SS confidence 


























































   371........380. ........390.........400..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions