Return to main results Retrieve Phyre Job Id

Job DescriptionP30235
Confidence59.35%DateThu Jan 5 11:46:18 GMT 2012
Rank71Aligned Residues33
% Identity39%Templatec1c0iA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:d-amino acid oxidase; PDBTitle: crystal structure of d-amino acid oxidase in complex with2 two anthranylate molecules
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60
Predicted Secondary structure 


























Query SS confidence 



























































Query Sequence  MREKDYVVIIGSANIDVAGYSHESLNYADSNPGKIKFTPGGVGRNIAQNLALLGNKAWLL
Query Conservation 
    





   

                       

   
 
  

 

     
Alig confidence 










...........................





















Template Conservation 
     
 


...........................


 


 
  

  
  
 

Template Sequence  MHSQKRVVVLG. . . . . . . . . . . . . . . . . . . . . . . . . . . SGVIGLSSALILARKGYSVHIL
Template Known Secondary structure 


S

...........................
STT
Template Predicted Secondary structure 






...........................




Template SS confidence 



























































   1001........1010. ........1020.........1030...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions