Return to main results Retrieve Phyre Job Id

Job DescriptionP39267
Confidence4.97%DateThu Jan 5 11:58:39 GMT 2012
Rank77Aligned Residues47
% Identity19%Templatec2iz1C_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:6-phosphogluconate dehydrogenase, decarboxylating; PDBTitle: 6pdh complexed with pex inhibitor synchrotron data
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   99100........ .110.........120.. .......130.........140.........150.........160..
Predicted Secondary structure  ..






Query SS confidence 









.













.







































Query Sequence  QKMDHRQHSA. FPELPQQIAALYEW. FSARCRWKEKALTQRGLLVQAGDQSEQIFTRWRAGAYNAW
Query Conservation 
      
 
.
 
   

  
   .   
   

  
 


   


    


 

 

 
   
Alig confidence 









.













.



.................


















Template Conservation 





 



 

 



  

    
  .................   

 

  

 
 
 
 
Template Sequence  VKMVHNGIEYGDMQLIAESYDLLKRILGLS. . . . . . . . . . . . . . . . . NAEIQAIFEEWNEGELDSY
Template Known Secondary structure  TS


.................TTTTT
B
Template Predicted Secondary structure 


.................



Template SS confidence 

































































   183......190.........200.........210.. .......220.........230.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions