Return to main results Retrieve Phyre Job Id

Job DescriptionP07650
Confidence24.45%DateWed Jan 25 15:20:12 GMT 2012
Rank137Aligned Residues42
% Identity14%Templatec3lgbB_
PDB info PDB header:transferaseChain: B: PDB Molecule:dna primase large subunit; PDBTitle: crystal structure of the fe-s domain of the yeast dna primase
Resolution1.54 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   4.....10.........20.........30.........40.........50.........60..
Predicted Secondary structure 














Query SS confidence 


























































Query Sequence  AQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLTMA
Query Conservation     

 

  
  

 

       
  
   
 





 

  

 
 


 

  
Alig confidence 

















..............










...












Template Conservation 
  
   
    

 
  ..............
 

 



 
...

  

 
 
 
 
Template Sequence  IKNLXEGLKKNHHLRYYG. . . . . . . . . . . . . . RQQLSLFLKGI. . . GLSADEALKFWSE
Template Known Secondary structure  S


..............T...T

Template Predicted Secondary structure 





..............
...


Template SS confidence 


























































   337..340.........350.... .....360..... ....370........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions