Return to main results Retrieve Phyre Job Id

Job DescriptionP75933
Confidence33.39%DateThu Jan 5 12:16:07 GMT 2012
Rank20Aligned Residues32
% Identity19%Templatec4a1cS_
PDB info PDB header:ribosomeChain: S: PDB Molecule:rpl26; PDBTitle: t.thermophila 60s ribosomal subunit in complex with2 initiation factor 6. this file contains 5s rrna,3 5.8s rrna and proteins of molecule 4.
Resolution3.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   162.......170.........180.........190.........200.....
Predicted Secondary structure 




















Query SS confidence 











































Query Sequence  VKAGQRVNVIASGDGFSANAEGQALNNAAVAQNARVRMVSGQVV
Query Conservation 
  
  
 
 
      
   
 

  
  
  


 
 

 

Alig confidence 











............



















Template Conservation 




 
 

 
............  


 


  
      
 
Template Sequence  VRKDDEVLIVRG. . . . . . . . . . . . KFKGNKGKVTQVYRKKWAIH
Template Known Secondary structure 

TT

SS............TTTT
TTTT
Template Predicted Secondary structure 



............







Template SS confidence 











































   4950.........60 .........70.........80
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions