Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF10
Confidence2.43%DateThu Jan 5 11:24:51 GMT 2012
Rank80Aligned Residues41
% Identity10%Templated1mnmc_
SCOP infoDNA/RNA-binding 3-helical bundle Homeodomain-like Homeodomain
Resolution2.25

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5960.........70.........80.........90.........100.........110.........120..
Predicted Secondary structure 
















Query SS confidence 































































Query Sequence  LLVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVINRQEYEDAELLMALREELNH
Query Conservation   

   
  

 


  

 

   













 




     

  





 


Alig confidence 






.............






















..........










Template Conservation    
   
.............      



  

  

   

..........
  

  

 
Template Sequence  RILESWF. . . . . . . . . . . . . AKNIENPYLDTKGLENLMKNTSL. . . . . . . . . . SRIQIKNWVSN
Template Known Secondary structure  .............TTSS





..........
Template Predicted Secondary structure  .............








..........
Template SS confidence 































































   142...... .150.........160.........170. ........180..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions