Return to main results Retrieve Phyre Job Id

Job DescriptionP24082
Confidence51.91%DateThu Jan 5 11:40:43 GMT 2012
Rank11Aligned Residues30
% Identity30%Templated1a8ra_
SCOP infoT-fold Tetrahydrobiopterin biosynthesis enzymes-like GTP cyclohydrolase I
Resolution2.10

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   495....500.........510.........520.........530......
Predicted Secondary structure 











Query SS confidence 









































Query Sequence  VSVGEFCSKKVLGVCLEKKRSYCQFDSKLAQIVQQQGRNGQL
Query Conservation     
 

  
 

 
      

 
 
 




  


  

Alig confidence 












............
















Template Conservation   





   


............



 


   





Template Sequence  ATVAYIPKDSVIG. . . . . . . . . . . . LSKINRIVQFFAQRPQV
Template Known Secondary structure 

SS
............SS
Template Predicted Secondary structure 



............




Template SS confidence 









































   121........130... ......140.........150
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions