Return to main results Retrieve Phyre Job Id

Job DescriptionP24082
Confidence8.83%DateThu Jan 5 11:40:43 GMT 2012
Rank87Aligned Residues33
% Identity12%Templatec3by5A_
PDB info PDB header:biosynthetic proteinChain: A: PDB Molecule:cobalamin biosynthesis protein; PDBTitle: crystal structure of cobalamin biosynthesis protein chig from2 agrobacterium tumefaciens str. c58
Resolution2.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   527..530.........540.........550.........560.........
Predicted Secondary structure 





















Query SS confidence 










































Query Sequence  VQQQGRNGQLRISFGSAKHPDCRGITVDELQKIQFNRLDFTNF
Query Conservation 
  


  


   
    
 
 
 
  
 
  

  

 

 
Alig confidence 





..





........




















Template Conservation 
 
 
 .. 

 

........     


          
  
Template Sequence  LAEAAK. . GLSLSL. . . . . . . . EIVAQERLEAVAAETXTFSQA
Template Known Secondary structure  ..TT

........

T
GG
Template Predicted Secondary structure  ..



........







Template SS confidence 










































   54..... 60..... ....70.........80......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions