Return to main results Retrieve Phyre Job Id

Job DescriptionP76352
Confidence1.84%DateThu Jan 5 12:22:17 GMT 2012
Rank48Aligned Residues46
% Identity11%Templatec2uvaI_
PDB info PDB header:transferaseChain: I: PDB Molecule:fatty acid synthase beta subunits; PDBTitle: crystal structure of fatty acid synthase from thermomyces2 lanuginosus at 3.1 angstrom resolution. this file contains3 the beta subunits of the fatty acid synthase. the entire4 crystal structure consists of one heterododecameric fatty5 acid synthase and is described in remark 400
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   52.......60.. ....... 70.. .......80.........90... ....
Predicted Secondary structure  .................
..
Query SS confidence 










. . . . . . . . . . . . . . . .






.


.




















.



Query Sequence  ENACVLLMGVL. . . . . . . . . . . . . . . . STFLVSW. LGK. DAMAGVGLADSFNMVIMAFFA. AIDL
Query Conservation        
   
................
   
  .

 .  

   

  
         .

  
Alig confidence 










................






.


.




















.



Template Conservation 











 
 




  


   
 








 



 
 
   
 
  








Template Sequence  TQFTQPALTLMEKASFEDMRSKGLVQRDSTFAGHSLGEYSALVALADVMPIESLVSVVFYRGLTM
Template Known Secondary structure  T


SS
STTS

S
Template Predicted Secondary structure 















Template SS confidence 
































































   1803......1810.........1820.........1830.........1840.........1850.........1860.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions