Return to main results Retrieve Phyre Job Id

Job DescriptionP77221
Confidence6.27%DateThu Jan 5 12:26:33 GMT 2012
Rank51Aligned Residues29
% Identity31%Templatec1s6yA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:6-phospho-beta-glucosidase; PDBTitle: 2.3a crystal structure of phospho-beta-glucosidase
Resolution2.31 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   361........370.........380.........390........
Predicted Secondary structure 



Query SS confidence 





































Query Sequence  ETYGIGGFAMATAPAIVALVGGTVEEAIDFSRQMREIT
Query Conservation 

 



 
 
 



   


    
      
  

Alig confidence 












.........















Template Conservation 

 
 

   


......... 
 
   

  
    
Template Sequence  ETNGPGGLFKGLR. . . . . . . . . TIPVILDIIRDXEELC
Template Known Secondary structure  SSST.........
Template Predicted Secondary structure 

.........
Template SS confidence 





































   112.......120.... .....130.........140
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions