Return to main results Retrieve Phyre Job Id

Job DescriptionP77221
Confidence6.29%DateThu Jan 5 12:26:33 GMT 2012
Rank49Aligned Residues31
% Identity32%Templatec1oy5B_
PDB info PDB header:transferaseChain: B: PDB Molecule:trna (guanine-n(1)-)-methyltransferase; PDBTitle: crystal structure of trna (m1g37) methyltransferase from aquifex2 aeolicus
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   369370.........380.........390.........400.........410....
Predicted Secondary structure 
















Query SS confidence 













































Query Sequence  AMATAPAIVALVGGTVEEAIDFSRQMREITLGENPNVTIPLLGFMG
Query Conservation 
 
 



   


    
      
  

   

    
   
 
Alig confidence 

















..............







.




Template Conservation 







 








..............
 
 



.    
Template Sequence  ALAVIDAVSRVLPGVLSE. . . . . . . . . . . . . . PYPVYTRP. REYRG
Template Known Secondary structure  STTTSS
..............





S
.STT
Template Predicted Secondary structure 






..............







.


Template SS confidence 













































   446...450.........460... ......470. .....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions