Return to main results Retrieve Phyre Job Id

Job DescriptionP17315
Confidence8.32%DateThu Jan 5 11:36:04 GMT 2012
Rank54Aligned Residues23
% Identity43%Templatec3lkxB_
PDB info PDB header:chaperoneChain: B: PDB Molecule:nascent polypeptide-associated complex subunit alpha; PDBTitle: human nac dimerization domain
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   71........80.........90.........100....
Predicted Secondary structure 
















Query SS confidence 

































Query Sequence  LKEVPGVQLTNEGDNRKGVSIRGLDSSYTLILVD
Query Conservation 
  



 
         
 


       
 

Alig confidence 







.........





..








Template Conservation 

 
 

 .........





.. 
  



 
Template Sequence  LRQVTGVT. . . . . . . . . RVTIRK. . SKNILFVIT
Template Known Secondary structure 




...........TTT
Template Predicted Secondary structure 



...........


Template SS confidence 

































   26...30... ...... 40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions