Return to main results Retrieve Phyre Job Id

Job DescriptionQ47710
Confidence3.50%DateThu Jan 5 12:37:08 GMT 2012
Rank17Aligned Residues52
% Identity13%Templatec3nz4A_
PDB info PDB header:lyaseChain: A: PDB Molecule:phenylalanine ammonia-lyase; PDBTitle: crystal structure of a taxus phenylalanine aminomutase
Resolution2.38 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   11........20........ .30.........40.........50.........60.........70.........80.
Predicted Secondary structure  .
Query SS confidence 

















.




















































Query Sequence  KAQLLSQIQQQRLDLSAS. RREWLETTGAYDRRWNMLLSLRSWALVGSSVMAIWTIRHPNMLVRWARRGFGV
Query Conservation 
  

  





 
   .   

  





 

 
 


  

 
  




 



 

    


 
 
Alig confidence 

















.













........







...........











Template Conservation         
  
       
       
  
   ........  

  
 ........... 

 


  


Template Sequence  TDTLVDRLAEFEKRLSDRLENEMTAVRVLYEKV. . . . . . . . RIQGSRFL. . . . . . . . . . . PFYRFVRDELDT
Template Known Secondary structure 


........
GGGSTT...........TTTT
Template Predicted Secondary structure 




........





...........


Template SS confidence 







































































   574.....580.........590.........600...... ...610.... .....620......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions