Return to main results Retrieve Phyre Job Id

Job DescriptionP64506
Confidence1.91%DateThu Jan 5 12:09:00 GMT 2012
Rank75Aligned Residues19
% Identity26%Templatec3g2bA_
PDB info PDB header:biosynthetic proteinChain: A: PDB Molecule:coenzyme pqq synthesis protein d; PDBTitle: crystal structure of pqqd from xanthomonas campestris
Resolution1.66 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   57..60.........70.........80.........
Predicted Secondary structure 




















Query SS confidence 
































Query Sequence  INPSTLVQYPLNDIAQKEVASGKTNAQPISVIQ
Query Conservation     
    




 
             

 

Alig confidence 















..............


Template Conservation 


 

    

 

 .............. 

Template Sequence  VLLAPERVVELDDIAL. . . . . . . . . . . . . . VVA
Template Known Secondary structure 








T..............
Template Predicted Secondary structure 




..............
Template SS confidence 
































   28.30.........40... ...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions