Return to main results Retrieve Phyre Job Id

Job DescriptionP37623
Confidence33.53%DateWed Jan 25 15:20:52 GMT 2012
Rank20Aligned Residues27
% Identity26%Templatec3k8aA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:putative primosomal replication protein; PDBTitle: neisseria gonorrhoeae prib
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   45....50.........60.........70.......
Predicted Secondary structure 



















Query SS confidence 
































Query Sequence  LSPLPEIIYGEQGKPAFAPEMPLWFNLSHSGDD
Query Conservation 
     
     


 
       





   
Alig confidence 
















......









Template Conservation 
  









  
 ...... 
 

     
Template Sequence  IEKAFPIRYTPAGIPVL. . . . . . DIILKHESWQ
Template Known Secondary structure 



TTS
......
Template Predicted Secondary structure 









......


Template SS confidence 
































   13......20......... 30.........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions