Return to main results Retrieve Phyre Job Id

Job DescriptionP37623
Confidence23.59%DateWed Jan 25 15:20:52 GMT 2012
Rank21Aligned Residues25
% Identity32%Templatec3en2A_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:probable primosomal replication protein n; PDBTitle: three-dimensional structure of the protein prib from2 ralstonia solanacearum at the resolution 2.3a. northeast3 structural genomics consortium target rsr213c.
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   45....50.........60.........70.....
Predicted Secondary structure 


















Query SS confidence 






























Query Sequence  LSPLPEIIYGEQGKPAFAPEMPLWFNLSHSG
Query Conservation 
     
     


 
       





 
Alig confidence 
















......







Template Conservation 
   

 
 



  
 ...... 
 

  
Template Sequence  LVEREVXRYTPAGVPIV. . . . . . NCLLSYSG
Template Known Secondary structure 



TT

......
Template Predicted Secondary structure 









......
Template SS confidence 






























   11........20....... ..30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions