Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEG4
Confidence89.95%DateThu Jan 5 11:23:14 GMT 2012
Rank195Aligned Residues33
% Identity15%Templatec3kp9A_
PDB info PDB header:blood coagulation,oxidoreductaseChain: A: PDB Molecule:vkorc1/thioredoxin domain protein; PDBTitle: structure of a bacterial homolog of vitamin k epoxide reductase
Resolution3.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   159160.........170.........180.........190.........200
Predicted Secondary structure 

















Query SS confidence 









































Query Sequence  KAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADT
Query Conservation    
   

 



 




         
             
Alig confidence 

























.........






Template Conservation    
    
 
 


 
 
    
   .........
  

  
Template Sequence  QECTEAGITSYPTWIINGRTYTGVRS. . . . . . . . . LEALAVA
Template Known Secondary structure  TTT

STTTTS


.........
Template Predicted Secondary structure 













.........
Template SS confidence 









































   242.......250.........260....... ..270....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions