Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEG4
Confidence75.17%DateThu Jan 5 11:23:14 GMT 2012
Rank232Aligned Residues33
% Identity30%Templatec1nm3B_
PDB info PDB header:electron transportChain: B: PDB Molecule:protein hi0572; PDBTitle: crystal structure of heamophilus influenza hybrid-prx5
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   158.160.........170.........180.........190.........200.....
Predicted Secondary structure 

















Query SS confidence 















































Query Sequence  EKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLS
Query Conservation     
   

 



 




         
             
  
 
Alig confidence 























...............








Template Conservation   

    
  


 




  


............... 


 
 
 
Template Sequence  VSVRAVSGRTTVPQVFIGGKHIGG. . . . . . . . . . . . . . . SDDLEKYFA
Template Known Secondary structure  S
SSS
TTS...............T
Template Predicted Secondary structure 








...............
Template SS confidence 















































   209210.........220.........230.. .......240.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions