Return to main results Retrieve Phyre Job Id

Job DescriptionP51024
Confidence8.25%DateThu Jan 5 12:04:50 GMT 2012
Rank18Aligned Residues36
% Identity25%Templatec3op0B_
PDB info PDB header:signaling protein/signaling protein reguChain: B: PDB Molecule:signal transduction protein cbl-c; PDBTitle: crystal structure of cbl-c (cbl-3) tkb domain in complex with egfr2 py1069 peptide
Resolution2.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8990.........100.........110.........120.........130......
Predicted Secondary structure 

















Query SS confidence 















































Query Sequence  IGFNFTDGNLIKKIFVDKLTQAQLINGRLAIARLLVDNNSEGEYAIIP
Query Conservation 
 



   


 
 
       
  
 



 
      
  
 


Alig confidence 



























............







Template Conservation 



   
 
 



 

 
 


 

 ............ 






Template Sequence  IGYVSSDGSILQTIPANKPLSQVLLEGQ. . . . . . . . . . . . KDGFYLYP
Template Known Secondary structure 
TTS



SS
............TTSS
Template Predicted Secondary structure 










............




Template SS confidence 















































   275....280.........290.........300.. .......310
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions