Return to main results Retrieve Phyre Job Id

Job DescriptionP51024
Confidence2.95%DateThu Jan 5 12:04:50 GMT 2012
Rank87Aligned Residues35
% Identity29%Templatec2glwA_
PDB info PDB header:transcriptionChain: A: PDB Molecule:92aa long hypothetical protein; PDBTitle: the solution structure of phs018 from pyrococcus horikoshii
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   98.100.........110.........120.........130.........140...
Predicted Secondary structure 












Query SS confidence 













































Query Sequence  LIKKIFVDKLTQAQLINGRLAIARLLVDNNSEGEYAIIPASVADKI
Query Conservation 


 
 
       
  
 



 
      
  
 


  




Alig confidence 









......









.....














Template Conservation 



      ......
     



.....  
 




 

 
 
Template Sequence  KIVKYEGEEP. . . . . . KEGTFTARVG. . . . . EQGSVIIPKALRDVI
Template Known Secondary structure  TT......

.....GGG

Template Predicted Secondary structure 



......
.....


Template SS confidence 













































   38.40....... ..50....... ..60.........70..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions