Return to main results Retrieve Phyre Job Id

Job DescriptionP64499
Confidence54.62%DateThu Jan 5 12:08:57 GMT 2012
Rank2Aligned Residues25
% Identity40%Templatec2rddB_
PDB info PDB header:membrane protein/transport proteinChain: B: PDB Molecule:upf0092 membrane protein yajc; PDBTitle: x-ray crystal structure of acrb in complex with a novel2 transmembrane helix.
Resolution3.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   18.20.........30.........40.........50........
Predicted Secondary structure 
Query SS confidence 








































Query Sequence  SVVVLLIGLILWFFINRASSRTNEQIELLEALLDQQKRQNA
Query Conservation      

  

 














 

  
 





  
Alig confidence 

















................






Template Conservation 
   
    




 


................



 

Template Sequence  ILMLVVFGLIFYFMILRP. . . . . . . . . . . . . . . . QQKRTKE
Template Known Secondary structure  T................
Template Predicted Secondary structure 
................
Template SS confidence 








































   24.....30.........40. .......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions