Return to main results Retrieve Phyre Job Id

Job DescriptionP32056
Confidence18.93%DateThu Jan 5 11:49:03 GMT 2012
Rank84Aligned Residues36
% Identity17%Templatec3brcA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:conserved protein of unknown function; PDBTitle: crystal structure of a conserved protein of unknown function from2 methanobacterium thermoautotrophicum
Resolution1.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   22.......30.........40.........50.........60........
Predicted Secondary structure 


















Query SS confidence 














































Query Sequence  FIVENSRGEFLLGKRTNRPAQGYWFVPGGRVQKDETLEAAFERLTMA
Query Conservation   

    
 


  
      
 
 



 

 


   

 


 
Alig confidence 











...........























Template Conservation 

  
 





...........
 







   
 


  
  
Template Sequence  LVIXDSRGRLLS. . . . . . . . . . . AAXSPPHVIHSXEVREAVRSEXTH
Template Known Secondary structure  TTS
...........

TTTS


Template Predicted Secondary structure 




...........



Template SS confidence 














































   112.......120... ......130.........140.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions