Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6Y5
Confidence20.82%DateThu Jan 5 11:04:13 GMT 2012
Rank38Aligned Residues24
% Identity17%Templatec2wulB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:glutaredoxin related protein 5; PDBTitle: crystal structure of the human glutaredoxin 5 with bound2 glutathione in an fes cluster
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   245....250.........260.. ......
Predicted Secondary structure 



........


Query SS confidence 

















. . . . . . . .





Query Sequence  PDEEVDSILAEDGEIDMH. . . . . . . . CDYCGN
Query Conservation 
  

  
  
   


 ........
 

  
Alig confidence 

















........





Template Conservation    
 
   
    



 
     
 

 
  
Template Sequence  SAEQLDALVKKDKVVVFLKGTPEQPQCGFSNA
Template Known Secondary structure 
SSSSB
SSSBSS
Template Predicted Secondary structure 











Template SS confidence 































   41........50.........60.........70..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions