Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADB1
Confidence7.22%DateThu Jan 5 11:20:30 GMT 2012
Rank22Aligned Residues32
% Identity28%Templatec3mtjA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:homoserine dehydrogenase; PDBTitle: the crystal structure of a homoserine dehydrogenase from thiobacillus2 denitrificans to 2.15a
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40.........50.........60.........70.....
Predicted Secondary structure 
















Query SS confidence 









































Query Sequence  PVVKDVKKGMSRAQVAQIAGKPSSEVSMIHARGTCQTYILGQ
Query Conservation 





  


  

  


 
 
        
 
  
 
  
Alig confidence 



















.........





.





Template Conservation 


  
   
 
  
  
 
.........




 .




 
Template Sequence  PIIKALREGLTANRIEWLAG. . . . . . . . . IINGTS. NFILSE
Template Known Secondary structure 
TTTTTS
.........

.
Template Predicted Secondary structure 




.........


.

Template SS confidence 









































   136...140.........150..... ....160. ......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions