Return to main results Retrieve Phyre Job Id

Job DescriptionP76219
Confidence14.04%DateThu Jan 5 12:20:43 GMT 2012
Rank4Aligned Residues44
% Identity14%Templated2iuba2
SCOP infoTransmembrane helix hairpin Magnesium transport protein CorA, transmembrane region Magnesium transport protein CorA, transmembrane region
Resolution2.9

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   159160.........170.........180.........190.........200.........210........
Predicted Secondary structure 



Query SS confidence 



























































Query Sequence  WPYTLISALTTLPGIVIYTVMASDLANEGITLRFILQLCLAGLALFILVQLAKLYARHKH
Query Conservation    
   
 

  
        
  
              
  
       
     


 
Alig confidence 








.














...............



















Template Conservation 
 


 
 
.




 







 ...............    
          




Template Sequence  KVLTIIATI. FMPLTFIAGIYGYPV. . . . . . . . . . . . . . . VLAVMGVIAVIMVVYFKKKK
Template Known Secondary structure  .TTS


...............TTTTS

Template Predicted Secondary structure  ................

Template SS confidence 



























































   292.......300 .........310..... ....320.........330.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions