Return to main results Retrieve Phyre Job Id

Job DescriptionP19636
Confidence8.73%DateThu Jan 5 11:37:24 GMT 2012
Rank92Aligned Residues18
% Identity28%Templatec3fybA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:protein of unknown function (duf1244); PDBTitle: crystal structure of a protein of unknown function (duf1244) from2 alcanivorax borkumensis
Resolution1.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   256...260.........270.........280.........
Predicted Secondary structure 













Query SS confidence 

































Query Sequence  RTCISNIHQGGTPPVEAAAVIVDLAKRMLEQKAS
Query Conservation 






   

   


     

   
    
Alig confidence 





................











Template Conservation 





................
   

 
 
  
Template Sequence  RNCLAK. . . . . . . . . . . . . . . . WLXEAATEQGVE
Template Known Secondary structure  ................T

Template Predicted Secondary structure  ................


Template SS confidence 

































   43..... .50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions