Return to main results Retrieve Phyre Job Id

Job DescriptionP76127
Confidence1.56%DateThu Jan 5 12:19:17 GMT 2012
Rank67Aligned Residues22
% Identity41%Templatec3u1hA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:3-isopropylmalate dehydrogenase; PDBTitle: crystal structure of ipmdh from the last common ancestor of bacillus
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40........ .50.....
Predicted Secondary structure 
........
Query SS confidence 














. . . . . . . .






Query Sequence  DDILMELTKWVEASD. . . . . . . . NDILSDI
Query Conservation 












 
........






Alig confidence 














........






Template Conservation 

    

  
  




  

 






Template Sequence  DNAAMQLIRNPRQFDVIVTENMFGDILSDE
Template Known Secondary structure 
GGG
S
Template Predicted Secondary structure 








Template SS confidence 





























   222.......230.........240.........250.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions