Return to main results Retrieve Phyre Job Id

Job DescriptionP76127
Confidence4.52%DateThu Jan 5 12:19:17 GMT 2012
Rank14Aligned Residues22
% Identity27%Templatec2e0cA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:409aa long hypothetical nadp-dependent isocitrate PDBTitle: crystal structure of isocitrate dehydrogenase from sulfolobus tokodaii2 strain7 at 2.0 a resolution
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40... ...... 50.....
Predicted Secondary structure  .....
...
Query SS confidence 









. . . . .





. . .





Query Sequence  DDILMELTKW. . . . . VEASDN. . . DILSDI
Query Conservation 









.....


 

...





Alig confidence 









.....





...





Template Conservation 
     

  
  




  








 
Template Sequence  DNMFQQIIIRPEEYDIILAPNVNGDYISDA
Template Known Secondary structure 
GGG
S
Template Predicted Secondary structure 








Template SS confidence 





























   274.....280.........290.........300...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions