Return to main results Retrieve Phyre Job Id

Job DescriptionP76127
Confidence1.30%DateThu Jan 5 12:19:17 GMT 2012
Rank77Aligned Residues22
% Identity45%Templatec1x0lB_
PDB info PDB header:oxidoreductaseChain: B: PDB Molecule:homoisocitrate dehydrogenase; PDBTitle: crystal structure of tetrameric homoisocitrate dehydrogenase from an2 extreme thermophile, thermus thermophilus
Resolution1.85 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   34.....40........ .50.....
Predicted Secondary structure 
........
Query SS confidence 














. . . . . . . .






Query Sequence  DDILMELTKWVEASD. . . . . . . . NDILSDI
Query Conservation 












 
........






Alig confidence 














........






Template Conservation 
     

  
  




  

 





 
Template Sequence  DNCAMQLVMRPERFDVIVTTNLLGDILSDL
Template Known Secondary structure 
GGG
S
Template Predicted Secondary structure 








Template SS confidence 





























   204.....210.........220.........230...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions