Return to main results Retrieve Phyre Job Id

Job DescriptionP37595
Confidence31.11%DateThu Jan 5 11:55:41 GMT 2012
Rank32Aligned Residues31
% Identity26%Templatec2otdC_
PDB info PDB header:hydrolaseChain: C: PDB Molecule:glycerophosphodiester phosphodiesterase; PDBTitle: the crystal structure of the glycerophosphodiester phosphodiesterase2 from shigella flexneri 2a
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........
Predicted Secondary structure 















Query SS confidence 






































Query Sequence  MGKAVIAIHGGAGAISRAQMSLQQELRYIEALSAIVETG
Query Conservation 
  
 







                  
  
   
Alig confidence 




















........









Template Conservation     







     



 ........ 
   
   
Template Sequence  WPYPRIVAHRGGGKLAPENTL. . . . . . . . AAIDVGAKYG
Template Known Secondary structure 



STTTTTTSS
SSS........TT
Template Predicted Secondary structure 














........

Template SS confidence 






































   4.....10.........20.... .....30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions