Return to main results Retrieve Phyre Job Id

Job DescriptionQ46861
Confidence37.04%DateWed Jan 25 15:21:13 GMT 2012
Rank67Aligned Residues39
% Identity38%Templatec3n5bB_
PDB info PDB header:transcription regulatorChain: B: PDB Molecule:asr0485 protein; PDBTitle: the complex of pii and pipx from anabaena
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   55....60.........70.........80.........90.........100.......
Predicted Secondary structure 
























Query SS confidence 




















































Query Sequence  YVDHPSFGMAICGRMLEAQGFRVGIIAQPDWSSKDDFMRLGKPNLFFGVTAGN
Query Conservation 







 
 


 

  
 




 

 
        

 




 

 
 
Alig confidence 









..........






....





















Template Conservation 









..........
 

  
....
   














   
Template Sequence  YINHPTWGLL. . . . . . . . . . YRICMVD. . . . ESQDLFTTLYAQRLFFLVGNDI
Template Known Secondary structure  TTT..............TTSSSS

SS
Template Predicted Secondary structure 





..........



....




Template SS confidence 




















































   910........ .20..... ....30.........40.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions