Return to main results Retrieve Phyre Job Id

Job DescriptionC0Z3X9
Confidence98.34%DateThu Jan 5 10:55:44 GMT 2012
Rank18Aligned Residues52
% Identity13%Templatec2is3B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:ribonuclease t; PDBTitle: crystal structure of escherichia coli rnase t
Resolution3.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.........60.........70.....
Predicted Secondary structure 































Query SS confidence 






































































Query Sequence  DKQPTFLFHDYETFGTHPALDRPAQFAAIRTDSEFNVIGEPEVFYCKPADDYLPQPGAVLITGITPQEARA
Query Conservation        
  
 




 
  
 



 

        
               
   
  
 


 
 
  
Alig confidence 






























.......









............










Template Conservation 
     



 




 
        
 
  .......       
 
............   
    
  
Template Sequence  FRGFYPVVIDVETLEIAAITLKXDEQGWLXP. . . . . . . DTTLHFHVEP. . . . . . . . . . . . GAVSEYEALHE
Template Known Secondary structure  TTT


TT

.......
............

Template Predicted Secondary structure 












.......









............






Template SS confidence 






































































   14.....20.........30.........40.... .....50.... .....60.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions