Return to main results Retrieve Phyre Job Id

Job DescriptionP26218
Confidence24.01%DateThu Jan 5 11:42:49 GMT 2012
Rank93Aligned Residues69
% Identity17%Templatec2wamB_
PDB info PDB header:unknown functionChain: B: PDB Molecule:conserved hypothetical alanine and leucine rich PDBTitle: crystal structure of mycobacterium tuberculosis unknown2 function protein rv2714
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910.........20.........30.........40.........50.........60.........70.........80........
Predicted Secondary structure 

























Query SS confidence 















































































Query Sequence  SAILLMAPLAFSAQSLAESLTVEQRLELLEKALRETQSELKKYKDEEKKKYTPATVNRSVSTNDQGYAANPFPTSSAAKP
Query Conservation                        
 

  

                                                  
Alig confidence 




































..................................








Template Conservation 

 


  
    

 

   
 
 
   
  
 
 
..................................    
    
Template Sequence  AAQALLEQVAKTGSLQLPLAVLAEAAAEVQAKIDEQV. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . QASAEVAQV
Template Known Secondary structure  T




..................................TT
Template Predicted Secondary structure 




..................................

Template SS confidence 















































































   225....230.........240.........250.........260. ........270
 
   8990.........100.........110.........120.........130..
Predicted Secondary structure 











Query SS confidence 











































Query Sequence  DAVLVKNEEKNASETGSIYSSMTLKDFSKFVKDEIGFSYNGYYR
Query Conservation                     
          
    






 
Alig confidence 










.....................











Template Conservation 
  

  

  .....................  
  
 
 

 
Template Sequence  VAALERQYDAF. . . . . . . . . . . . . . . . . . . . . IDAGAEFERFLA
Template Known Secondary structure  .....................


Template Predicted Secondary structure 


.....................
Template SS confidence 











































   271........280. ........290...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions