Return to main results Retrieve Phyre Job Id

Job DescriptionP26218
Confidence72.57%DateThu Jan 5 11:42:49 GMT 2012
Rank20Aligned Residues31
% Identity29%Templatec1aq5C_
PDB info PDB header:coiled-coilChain: C: PDB Molecule:cartilage matrix protein; PDBTitle: high-resolution solution nmr structure of the trimeric coiled-coil2 domain of chicken cartilage matrix protein, 20 structures
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.
Predicted Secondary structure 











Query SS confidence 








































Query Sequence  MFRRNLITSAILLMAPLAFSAQSLAESLTVEQRLELLEKAL
Query Conservation                                
 

  

   
Alig confidence 

















..........












Template Conservation   

  
   

 

 


.......... 

 


 


 
Template Sequence  KFQTKVEELINTLQQKLE. . . . . . . . . . AVAKRIEALENKI
Template Known Secondary structure  ..........
Template Predicted Secondary structure  ..........
Template SS confidence 








































   16...20.........30... ......40......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions