Return to main results Retrieve Phyre Job Id

Job DescriptionP77529
Confidence2.71%DateThu Jan 5 12:30:19 GMT 2012
Rank79Aligned Residues28
% Identity29%Templatec3g43F_
PDB info PDB header:metal binding proteinChain: F: PDB Molecule:voltage-dependent l-type calcium channel subunit PDBTitle: crystal structure of the calmodulin-bound cav1.2 c-terminal2 regulatory domain dimer
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   420.........430.........440.........450.........460
Predicted Secondary structure 



Query SS confidence 








































Query Sequence  LIDMGRTALNVSGSMTAGTLTSQWLKQTDKAILDSEDDAEL
Query Conservation    
  

  

 

   
 

       
          
 
Alig confidence 










...........








..







Template Conservation 








 
...........
      
 ..
 


  
Template Sequence  LFALVRTALRI. . . . . . . . . . . KTEGNLEQA. . NEELRAII
Template Known Secondary structure  .............
Template Predicted Secondary structure 
...........

..
Template SS confidence 








































   1610.........1620 ......... 1630.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions