Return to main results Retrieve Phyre Job Id

Job DescriptionP76578
Confidence21.21%DateWed Jan 25 15:21:09 GMT 2012
Rank157Aligned Residues27
% Identity22%Templatec2kq0A_
PDB info PDB header:ligaseChain: A: PDB Molecule:e3 ubiquitin-protein ligase nedd4; PDBTitle: human nedd4 3rd ww domain complex with ebola zaire virus matrix2 protein vp40 derived peptide ilptappeymea
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1550.........1560.........1570.........1580.........1590.........1600.........1610
Predicted Secondary structure 









































Query SS confidence 




























































Query Sequence  LLPAGLELENQNLANGSASLEQSGGEVQNLLNQMQQASIKHIEFRDDRFVAAVAVDEYQPV
Query Conservation   



 
     
                             
 

  
            
Alig confidence 







.................................






.











Template Conservation   

 


 .................................     

. 




 
  
 
Template Sequence  FLPKGWEV. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . RHAPNGR. PFFIDHNTKTTT
Template Known Secondary structure 


TT.................................TTT.TTTT
Template Predicted Secondary structure 






.................................




.



Template SS confidence 




























































   12....... 20...... ...30........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions