Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFA7
Confidence3.33%DateThu Jan 5 11:25:45 GMT 2012
Rank35Aligned Residues53
% Identity21%Templatec3ifxB_
PDB info PDB header:membrane proteinChain: B: PDB Molecule:voltage-gated potassium channel; PDBTitle: crystal structure of the spin-labeled kcsa mutant v48r1
Resolution3.56 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   430.........440.... .....450.........460.........470.........480.........490.........500......
Predicted Secondary structure 

.






Query SS confidence 














.





























































Query Sequence  YELLAVAINTGTNLP. SVATPNGQAAFLFLLTSALAPLIRLSYGRMVWMALPYTLVLTLVGLLCVEFTLAPVTEWFMQ
Query Conservation     
  


 

 
 .

 
 








   
   
  


 

 
 
 
 


   
 
  
   
         
Alig confidence 














.














........................






















Template Conservation   

 
    









 
 
  


   ........................   
 
    
     
 
    
Template Sequence  PRALWWSVETATTVGYGDLYPVTLWGRLVAV. . . . . . . . . . . . . . . . . . . . . . . . VVMVAGITSFGLVTAALATWFVG
Template Known Secondary structure  TTT


SS



S........................T
Template Predicted Secondary structure 










........................
Template SS confidence 













































































   62.......70.........80.........90.. .......100.........110.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions