Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFA7
Confidence2.69%DateThu Jan 5 11:25:45 GMT 2012
Rank47Aligned Residues24
% Identity25%Templatec1yfsB_
PDB info PDB header:ligaseChain: B: PDB Molecule:alanyl-trna synthetase; PDBTitle: the crystal structure of alanyl-trna synthetase in complex2 with l-alanine
Resolution2.08 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   468.470.........480.........490.........500....
Predicted Secondary structure 


Query SS confidence 




































Query Sequence  RLSYGRMVWMALPYTLVLTLVGLLCVEFTLAPVTEWF
Query Conservation   


 

 
 
 
 


   
 
  
   
       
Alig confidence 










.............












Template Conservation 








 
.............

  





  
Template Sequence  NFSFGDYFKKE. . . . . . . . . . . . . AIEYAWEFVTEVL
Template Known Secondary structure  SS

.............TTS
Template Predicted Secondary structure  .............
Template SS confidence 




































   95....100..... ....110........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions