Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7I0
Confidence44.24%DateThu Jan 5 11:05:42 GMT 2012
Rank17Aligned Residues54
% Identity17%Templatec2ps3A_
PDB info PDB header:metal transportChain: A: PDB Molecule:high-affinity zinc uptake system protein znua; PDBTitle: structure and metal binding properties of znua, a2 periplasmic zinc transporter from escherichia coli
Resolution2.47 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50.........60.........70 .........80.........90.........100
Predicted Secondary structure 





.


Query SS confidence 













































.





























Query Sequence  DAQTIADQERFRALSREYAQLSDVSRCFTDWQQVQEDIETAQMMLD. DPEMREMAQDELREAKEKSEQLEQQLQVLL
Query Conservation   
  
 
   
  
 

   
   
     
     

  
 

  .
 
  


  
       
  
   

  
Alig confidence 




















......................


.





























Template Conservation 


 

 
      
  
   ......................
   

     
  
       
  
        
Template Sequence  NMHLWLSPEIARATAVAIHGK. . . . . . . . . . . . . . . . . . . . . . LVELMPQSRAKLDANLKDFEAQLASTETQVGNEL
Template Known Secondary structure 

GGG
......................
STT
Template Predicted Secondary structure 



......................
Template SS confidence 












































































   141........150.........160. ........170.........180.........190.....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions