Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7I0
Confidence36.65%DateThu Jan 5 11:05:42 GMT 2012
Rank26Aligned Residues54
% Identity24%Templatec2ov3A_
PDB info PDB header:transport proteinChain: A: PDB Molecule:periplasmic binding protein component of an abc PDBTitle: crystal structure of 138-173 znua deletion mutant plus zinc2 bound
Resolution2.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50.........60.........70 .........80.........90.........100
Predicted Secondary structure 





.


Query SS confidence 













































.





























Query Sequence  DAQTIADQERFRALSREYAQLSDVSRCFTDWQQVQEDIETAQMMLD. DPEMREMAQDELREAKEKSEQLEQQLQVLL
Query Conservation   
  
 
   
  
 

   
   
     
     

  
 

  .
 
  


  
       
  
   

  
Alig confidence 




















......................


.





























Template Conservation 


 



      
  

  ......................
    
     
  
       
  
        
Template Sequence  DPHIWLSPTLVKRQATTIAKE. . . . . . . . . . . . . . . . . . . . . . LAELDPDNRDQYEANLAAFLAELERLNQELGQIL
Template Known Secondary structure 


GGG
......................
GGG
Template Predicted Secondary structure 


......................
Template SS confidence 












































































   177..180.........190....... ..200.........210.........220.........230.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions