Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7I0
Confidence27.26%DateThu Jan 5 11:05:42 GMT 2012
Rank39Aligned Residues54
% Identity13%Templatec2o1eB_
PDB info PDB header:structural genomics, unknown functionChain: B: PDB Molecule:ycdh; PDBTitle: crystal structure of the metal-dependent lipoprotein ycdh2 from bacillus subtilis, northeast structural genomics3 target sr583
Resolution2.60 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   25....30.........40.........50.........60.........70 .........80.........90.........100
Predicted Secondary structure 





.


Query SS confidence 













































.





























Query Sequence  DAQTIADQERFRALSREYAQLSDVSRCFTDWQQVQEDIETAQMMLD. DPEMREMAQDELREAKEKSEQLEQQLQVLL
Query Conservation   
  
 
   
  
 

   
   
     
     

  
 

  .
 
  


  
       
  
   

  
Alig confidence 















......................







.





























Template Conservation 


 



      
 ...................... 

  
   

     
  
       
  
        
Template Sequence  DPHVWLSPVLAQKEVK. . . . . . . . . . . . . . . . . . . . . . NITAQIVKQDPDNKEYYEKNSKEYIAKLQDLDKLYRTTA
Template Known Secondary structure 

GGGGS......................
GGG
Template Predicted Secondary structure 



......................
Template SS confidence 












































































   126...130.........140. ........150.........160.........170.........180
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions