Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAY1
Confidence2.79%DateThu Jan 5 11:14:06 GMT 2012
Rank62Aligned Residues30
% Identity37%Templated1dmga_
SCOP infoRibosomal protein L4 Ribosomal protein L4 Ribosomal protein L4
Resolution1.70

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7..10.........20.........30.........40.........50.........
Predicted Secondary structure 










Query SS confidence 




















































Query Sequence  RIDLLNRLIDARVDLAAYVQLRKAKGYMSVSESNHLRDNFFKLNRELHDKSLR
Query Conservation     

  

 
 

  

 












  




 
 
 

      
Alig confidence 











.......................

















Template Conservation     


  
  
....................... 



 






 



Template Sequence  NYDVMWRYVDMQ. . . . . . . . . . . . . . . . . . . . . . . LSDWSKKLNKKMKKLALR
Template Known Secondary structure 
.......................

Template Predicted Secondary structure 
.......................






Template SS confidence 




















































   2930.........40 .........50........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions