Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF96
Confidence59.88%DateThu Jan 5 11:25:39 GMT 2012
Rank4Aligned Residues59
% Identity19%Templatec3cewA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized cupin protein; PDBTitle: crystal structure of a cupin protein (bf4112) from bacteroides2 fragilis. northeast structural genomics consortium target bfr205
Resolution2.31 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   63......70.........80.........90.........100.........110.........120.........130.........140..
Predicted Secondary structure 




































Query SS confidence 















































































Query Sequence  YHARYLDIQIVLKGQEGMTFSTQPAGAPDTDWLADKDIAFLPEGVDEKTVILNEGDFVVFYPGEVHKPLCAVGAPAQVRK
Query Conservation   
  




  
 
 
 
             
    
  
         
 
  
 





 
 
 
         


Alig confidence 



















.........................























..








Template Conservation   
   

   

 
      ......................... 
    
  

 
 


   
   ..
 



   
Template Sequence  SHKQNEEIYGILSGKGFITI. . . . . . . . . . . . . . . . . . . . . . . . . DGEKIELQAGDWLRIAPDGKRQIS. . AASDSPIGF
Template Known Secondary structure 

SS.........................TTTT

TT

..BTTB
Template Predicted Secondary structure 






.........................






..




Template SS confidence 















































































   44.....50.........60... ......70.........80....... ..90......
 
   143.....
Predicted Secondary structure 
Query SS confidence 





Query Sequence  AVVKML
Query Conservation   
 

 
Alig confidence 





Template Conservation 
 
   
Template Sequence  LCIQVK
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 





   97..100..
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions