Return to main results Retrieve Phyre Job Id

Job DescriptionP0AF96
Confidence2.91%DateThu Jan 5 11:25:39 GMT 2012
Rank94Aligned Residues35
% Identity20%Templatec2d40C_
PDB info PDB header:oxidoreductaseChain: C: PDB Molecule:putative gentisate 1,2-dioxygenase; PDBTitle: crystal structure of z3393 from escherichia coli o157:h7
Resolution2.41 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   70.........80.........90.........100.........110.........120.........
Predicted Secondary structure 
























Query SS confidence 



























































Query Sequence  IQIVLKGQEGMTFSTQPAGAPDTDWLADKDIAFLPEGVDEKTVILNEGDFVVFYPGEVHK
Query Conservation 

  
 
 
 
             
    
  
         
 
  
 





 
 
 
Alig confidence 












.........................





















Template Conservation 
  

 
 
   
......................... 
       

   

    
 
Template Sequence  IYHVVEGSGQVII. . . . . . . . . . . . . . . . . . . . . . . . . GNETFSFSAKDIFVVPTWHGVS
Template Known Secondary structure 
.........................TTTT

TT

Template Predicted Secondary structure 
.........................










Template SS confidence 



























































   279280.........290. ........300.........310...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions