Return to main results Retrieve Phyre Job Id

Job DescriptionP77522
Confidence35.50%DateThu Jan 5 12:30:15 GMT 2012
Rank18Aligned Residues34
% Identity26%Templated1eqzb_
SCOP infoHistone-fold Histone-fold Nucleosome core histones
Resolution2.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   462.......470........ .480.........490.....
Predicted Secondary structure 

.............

Query SS confidence 
















. . . . . . . . . . . . .
















Query Sequence  IVNGFCKDVFSELPLEF. . . . . . . . . . . . . AVEAQKLLAISLEHSVG
Query Conservation 

 

   

  

 
 .............  

  

   

   
Alig confidence 
















.............
















Template Conservation 













 


 

   

 


 















Template Sequence  IMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELA
Template Known Secondary structure  TT




S
Template Predicted Secondary structure 





Template SS confidence 














































   61........70.........80.........90.........100.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions