Return to main results Retrieve Phyre Job Id

Job DescriptionP75757
Confidence22.62%DateThu Jan 5 12:13:49 GMT 2012
Rank14Aligned Residues23
% Identity35%Templatec2kpsA_
PDB info PDB header:structural genomics, unknown functionChain: A: PDB Molecule:uncharacterized protein; PDBTitle: solution structure of domain iv from the ybbr family protein of2 desulfitobacterium hafniense
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   281........290.........300.........310...
Predicted Secondary structure 

























Query SS confidence 
































Query Sequence  QIEHATIQMEYQPCHGPDCHLNEGVSGHSHHHH
Query Conservation   
   

 

                 
     
Alig confidence 











..........










Template Conservation   
 
 



  
..........
          
Template Sequence  SIPDVTYTLKAK. . . . . . . . . . EDPLEHHHHHH
Template Known Secondary structure 




..........


S
SS



Template Predicted Secondary structure 


..........





Template SS confidence 
































   76...80....... ..90........
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions